PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 295aa    MW: 33519.7 Da    PI: 8.6031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20871.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33e-071560346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT e+ +++  a + + ++   +W ++a++++ g+t  +++  ++ 
       KHN20871.1 15 EWTREDNKKFESALAIYDNDtpdRWFKVAAMIP-GKTVFDVIKQYRE 60
                     7********************************.****999999875 PP

2Myb_DNA-binding40.56.3e-13115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
       KHN20871.1 115 PWTEDEHRRFLMGLLKYGKGDWRNISRNFVVTKTPTQVASHAQKY 159
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.0441166IPR017884SANT domain
SMARTSM007172.2E-81264IPR001005SANT/Myb domain
SuperFamilySSF466893.51E-111468IPR009057Homeodomain-like
CDDcd001675.76E-71561No hitNo description
PfamPF002494.4E-61560IPR001005SANT/Myb domain
PROSITE profilePS5129418.763108164IPR017930Myb domain
SuperFamilySSF466899.72E-16110164IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-17111163IPR006447Myb domain, plants
SMARTSM007172.3E-10112162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-10112158IPR009057Homeodomain-like
CDDcd001671.57E-8115159No hitNo description
PfamPF002491.9E-10115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MPNSNWFVQE SHSTEWTRED NKKFESALAI YDNDTPDRWF KVAAMIPGKT VFDVIKQYRE  60
LEEDVSEIEA GRVPIPGYLA SSFTFELVDN HNYDGCRRRL APVRGSDQER KKGVPWTEDE  120
HRRFLMGLLK YGKGDWRNIS RNFVVTKTPT QVASHAQKYY IRQKVSGGKD KRRPSIHDIT  180
TVNLTETSAS DKNKPQLFNA SPVLAPQQKL NSISKVQLGW TSSHYNDGSF MVFNPNSDAL  240
FVSSSPDVTS MALKMQGQDL YDCALHEAYA KVKVPGFSMA PRDFNNEAVF GIHAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1516781173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-143AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235748.10.0MYB transcription factor MYB75
SwissprotQ8S9H76e-89DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2QH860.0A0A0B2QH86_GLYSO; Transcription factor MYB1R1
STRINGGLYMA14G06750.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-90MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]